missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DNAH14 Control Fragment Recombinant Protein

Catalog No. RP105792
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105792 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105792 Supplier Invitrogen™ Supplier No. RP105792
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83018 (PA5-83018. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly.

Specifications

Accession Number Q0VDD8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 127602
Name Human DNAH14 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Axonemal beta dynein heavy chain 14; C1orf67; Ciliary dynein heavy chain 14; DNAH14; Dnahc14; dynein axonemal heavy chain 14; dynein heavy chain 14, axonemal; dynein, axonemal, heavy chain 14; dynein, axonemal, heavy polypeptide 14; HL18; HL-18
Common Name DNAH14
Gene Symbol DNAH14
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TGKLNAKRIKTEKSRSFLYHHLFLADDLFQTCLVYIRGLCEDAINLKNYNDHENNLSAICLVKLDSSRTYSLDEFCEEQLQQAT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less