missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CDS2 (aa 1-67) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91212
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54061 (PA5-54061. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin.Specifications
| O95674 | |
| Blocking Assay, Control | |
| 8760 | |
| 100 μL | |
| 5730450N06Rik; 5730460C18Rik; AI854580; CDP-DAG synthase 2; CDP-DG synthase 2; CDP-DG synthetase 2; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2; CDP-diacylglycerol synthase 2; CDP-diglyceride diphosphorylase 2; CDP-diglyceride pyrophosphorylase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDS 2; CDS2; CTP:phosphatidate cytidylyltransferase 2; D2Wsu127e; Phosphatidate cytidylyltransferase 2 | |
| CDS2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CDS2 (aa 1-67) Control Fragment | |
| RUO | |
| CDS2 | |
| Unconjugated | |
| Recombinant | |
| MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |