missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Axotrophin (aa 233-378) Control Fragment Recombinant Protein

Catalog No. RP90852
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90852 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90852 Supplier Invitrogen™ Supplier No. RP90852
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54572 (PA5-54572. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of protein remains unknown.

Specifications

Accession Number Q9H992
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64844
Name Human Axotrophin (aa 233-378) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AXO; AXOT; Axotrophin; C3HC4 7; DKFZP586F1122; E3 ubiquitin-protein ligase MARCH7; gene trap ROSA b-geo 17; Gtrgeo17; MARCH7; MARCHF7; MARCH-VII; membrane associated ring finger 7; membrane associated ring-CH-type finger 7; membrane-associated ring finger (C3HC4) 7; membrane-associated ring finger (C3HC4) 7, E3 ubiquitin protein ligase; membrane-associated RING finger protein 7; Membrane-associated RING-CH protein VII; RING finger protein 177; RING-type E3 ubiquitin transferase MARCH7; RNF177
Common Name Axotrophin
Gene Symbol MARCH7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSRSNTQPGFSYSSSRDEAPIISNSERVVSSQRPFQESSDNEGRRTTRRLLSRIASSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVPDNRASEASQGFRFLRRRWGLSSLSHNHSSESDSENFNQESE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less