missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

HSD17B10, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Supplier:  Abnova Corporation H00003028B01P

Catalog No. 89-020-178



Description

Description

Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Specifications

Specifications

HSD17B10
Polyclonal
In 1x PBS, pH 7.4
NM_004493.2
HSD17B10
HSD17B10 (NP_004484.1, 1 a.a. ∼ 261 a.a) full-length human protein.
RUO
3028
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Purified
Immunofluorescence,Western Blot
Unconjugated
hydroxysteroid (17-beta) dehydrogenase 10
17b-HSD10/ABAD/CAMR/DUPXp11.22/ERAB/HADH2/HCD2/MHBD/MRPP2/MRX17/MRX31/MRXS10/SCHAD/SDR5C1
Mouse
50 μg
Primary
Human
Antibody
SDS
Documents

Documents

Product Certifications
Promotions

Promotions