missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

GALE, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Supplier:  Abnova Corporation H00002582B01P

Catalog No. 89-020-115



Description

Description

Sequence: MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Specifications

Specifications

GALE
Polyclonal
In 1x PBS, pH 7.4
NM_000403.3
GALE
GALE (NP_000394.2, 1 a.a. ∼ 348 a.a) full-length human protein.
RUO
2582
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Purified
Western Blot
Unconjugated
UDP-galactose-4-epimerase
FLJ95174/FLJ97302/SDR1E1
Mouse
50 μg
Primary
Human
Antibody
SDS
Documents

Documents

Product Certifications
Promotions

Promotions