missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

FOXI1, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Supplier:  Abnova Corporation H00002299B02P

Catalog No. 89-020-094



Description

Description

Sequence: MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV
Specifications

Specifications

FOXI1
Polyclonal
In 1x PBS, pH 7.4
NM_144769.1
FOXI1
FOXI1 (NP_658982.1, 1 a.a. ∼ 283 a.a) full-length human protein.
RUO
2299
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Purified
Immunofluorescence,Western Blot
Unconjugated
forkhead box I1
FKH10/FKHL10/FREAC6/HFH3/MGC34197
Mouse
50 μg
Primary
Human
Antibody
SDS
Documents

Documents

Product Certifications
Promotions

Promotions