Please login to your online account to display your discounted pricing

Novus Biologicals™ ERK1 Inhibitor Peptide Set

For use in research applications

$461.00 - $966.00

Specifications

Product Type ERK1 Inhibitor Peptide Set
Inhibitors ERK1
Molecular Weight 3795
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Quantity Price Quantity    

NBP229333

 
novus biologicals™
NBP2-29333
2mg Each for $461.00

NBP2293335

 
novus biologicals™
NBP2-29333-5MG
5mg Each for $966.00
Description & Specifications

Specifications

Product Type ERK1 Inhibitor Peptide Set
Inhibitors ERK1
Molecular Weight 3795
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized
For Use With (Application) Inhibition of Erk activation
Includes ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361