missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Novus Biologicals™ ERK1 Inhibitor Peptide Set

For use in research applications

$442.22 - $948.07

Specifications

Product Type ERK1 Inhibitor Peptide Set
Host Species Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Inhibitors ERK1
Molecular Weight 3795
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP229333 Novus Biologicals™
NBP229333
2mg Each for $442.22
NBP2293335 Novus Biologicals™
NBP2293335MG
5mg Each for $948.07
Specifications Description & Specifications

Specifications

ERK1 Inhibitor Peptide Set
ERK1
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Inhibition of Erk activation
Human, Mouse, Rat, Hamster, Rabbit, Xenopus
3795
Lyophilized
ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361