Please login to your online account to display your discounted pricing

Novus Biologicals™ ERK1 Inhibitor Peptide Set

For use in research applications

$442.22 - $948.07


Product Type ERK1 Inhibitor Peptide Set
Host Species Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Inhibitors ERK1
Molecular Weight 3795
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
View More Specs


For Research Use Only

Catalog Number Mfr. No. Quantity Price Quantity    


novus biologicals™
2mg Each for $442.22


novus biologicals™
5mg Each for $948.07
Description & Specifications


Product Type ERK1 Inhibitor Peptide Set
Host Species Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Inhibitors ERK1
Molecular Weight 3795
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized
For Use With (Application) Inhibition of Erk activation
Includes ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361