missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Novus Biologicals™ ERK1 Inhibitor Peptide Set

For use in research applications

Manufacturer:  Novus Biologicals™ NBP2293335MG

 View more versions of this product

Catalog No. NBP2293335


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

5mg
Inhibition of Erk activation
Lyophilized
ERK1
Human, Mouse, Rat, Hamster, Rabbit, Xenopus
ERK1 Inhibitor Peptide Set
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
3795