Please login to your online account to display your discounted pricing

Novus Biologicals™ ERK1 Inhibitor Peptide Set

For use in research applications

Manufacturer: novus biologicals™  NBP2-29333-5MG

 View all options for this product

Catalog No. NBP2293335

Description & Specifications

Product Type ERK1 Inhibitor Peptide Set
Format Lyophilized
Inhibitors ERK1
Molecular Weight 3795
Includes ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Quantity 5mg
For Use With (Application) Inhibition of Erk activation
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.