missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

E2F2, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Supplier:  Abnova Corporation H00001870B01P

Catalog No. 89-020-052



Description

Description

Sequence: MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR
Specifications

Specifications

E2F2
Polyclonal
In 1x PBS, pH 7.4
BC007609
E2F2
E2F2 (AAH07609, 1 a.a. ∼ 83 a.a) full-length human protein.
RUO
1870
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Purified
Western Blot
Unconjugated
E2F transcription factor 2
E2F-2
Mouse
50 μg
Primary
Human
Antibody
SDS
Documents

Documents

Product Certifications
Promotions

Promotions