missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Please login to your online account to display your discounted pricing
Abnova™ CLDN2 (Human) Recombinant Protein
Human CLDN2 full-length ORF ( NP_065117.1, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
Supplier: Abnova™ H00009075P012
Description
- Sequence: MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Specifications
| NP_065117.1 | |
| claudin 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 9075 | |
| Wheat germ expression system | |
| 2 μg | |
| CLDN2 | |
| GST |