Please login to your online account to display your discounted pricing

anti-ZEB1, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP188845

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP188845

  • / Each
 

Description & Specifications

Specifications

Format Affinity Purified
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Regulatory Status RUO
Host Species Rabbit
Cross Reactivity Human
Quantity 0.1mL
Antigen ZEB1
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected to cross react based on sequence identity: Mouse (74%), Rat (77%)
Conjugate Unlabeled
Gene ID (Entrez) 6935
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Accession No. P37275
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST