Please login to your online account to display your discounted pricing

anti-ZEB1, Polyclonal, Novus Biologicals™

$450.00 - $450.00

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Antigen ZEB1
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Conjugate Quantity Price Quantity    

NBP188845

 
novus biologicals canada
NBP1-88845
Unlabeled 0.1mL Each for $450.00
Description & Specifications

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Antigen ZEB1
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
Primary or Secondary Primary
Regulatory Status RUO
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected to cross react based on sequence identity: Mouse (74%), Rat (77%)
Gene Accession No. P37275
Gene ID (Entrez) 6935
Formulation PBS, pH 7.2, containing 40% glycerol