Please login to your online account to display your discounted pricing

anti-ZDHHC2, Polyclonal, Novus Biologicals™

Manufacturer: novus biologicals canada  NBP2-13541

 View all options for this product


For Research Use Only

Catalog No. NBP213541


Description & Specifications


Antigen ZDHHC2
Applications Immunohistochemistry
Conjugate Unlabeled
Cross Reactivity Human
Format Affinity Purified
Formulation 40% glycerol and PBS pH 7.2.
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 51201
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.