Please login to your online account to display your discounted pricing

anti-ZDHHC2, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP2-13541

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP213541

  • / Each
 

Description & Specifications

Specifications

Antigen ZDHHC2
Applications Immunohistochemistry
Conjugate Unlabeled
Cross Reactivity Human
Format Affinity Purified
Formulation 40% glycerol and PBS pH 7.2.
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 51201
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.