missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-ZDHHC2, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP213541

 View more versions of this product

Catalog No. NBP213541


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

ZDHHC2
Unlabeled
Affinity Purified
This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
RUO
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry
40% glycerol and PBS pH 7.2.
Rabbit
0.1mL
Primary
51201
Human