missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-ZDHHC2, Polyclonal, Novus Biologicals™

$461.00 - $461.00

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
Antigen ZDHHC2
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP213541 Novus Biologicals Canada
NBP213541
0.1mL Each for $461.00
Specifications Description & Specifications

Specifications

Rabbit
ZDHHC2
Affinity Purified
RUO
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
40% glycerol and PBS pH 7.2.
This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
Polyclonal
Primary
Immunohistochemistry
51201