Please login to your online account to display your discounted pricing

anti-ZDHHC2, Polyclonal, Novus Biologicals™

$450.00 - $450.00

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
Antigen ZDHHC2
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Conjugate Quantity Price Quantity    

NBP213541

 
novus biologicals canada
NBP2-13541
Unlabeled 0.1mL Each for $450.00
Description & Specifications

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
Antigen ZDHHC2
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
Primary or Secondary Primary
Regulatory Status RUO
Applications Immunohistochemistry
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Gene ID (Entrez) 51201
Formulation 40% glycerol and PBS pH 7.2.