missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

vaccinia related kinase 3 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human VRK3 protein.

Supplier:  Abnova Corporation H00051231B01

Catalog No. 89-007-616



Description

Description

This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be required for catalysis. In vitro assays indicate the protein lacks phosphorylation activity. The protein, however, likely retains its substrate binding capability. This gene is widely expressed in human tissues and its protein localizes to the nucleus. Alternative splicing results in multiple transcripts encoding different isoforms. [provided by RefSeq

Sequence: MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKLPWDSF
Specifications

Specifications

vaccinia related kinase 3
Polyclonal
Mouse polyclonal antibody raised against a full-length human VRK3 protein.
VRK3
VRK3
VRK3 (AAH23556.1, 1 a.a. ∼ 412 a.a) full-length human protein.
RUO
Yes
51231
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot
Unconjugated
No additive
BC023556.2
Mouse
50 μL
Kinases
Primary
Human
Serum
SDS
Documents

Documents

Product Certifications
Promotions

Promotions