Please login to your online account to display your discounted pricing

anti-TUSC4, Polyclonal, Novus Biologicals™

$139.00 - $139.00


Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Antigen TUSC4
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs


For Research Use Only

Catalog Number Mfr. No. Conjugate Quantity Price Quantity    


novus biologicals canada
Unlabeled 0.01mg Each for $139.00
Description & Specifications


Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Antigen TUSC4
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
Primary or Secondary Primary
Regulatory Status RUO
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blot
Test Specificity Expected identity based on immunogen sequence: Western clawed frog; Green puffer: 100%; Atlantic salmon: 100%; Human: 100%; Trichoplax reptans: 85%; Xenopus: 85%; Florida lancelet: 78%; Starlet sea anemone: 76%.
Gene Accession No. NP_006536
Gene ID (Entrez) 10641
Formulation PBS and 2% Sucrose lyophilized with the antibody.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.