missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-TUSC4, Polyclonal, Novus Biologicals™

$139.00 - $139.00

Specifications

Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Antigen TUSC4
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP179375SS Novus Biologicals Canada
NBP179375SS
0.01mg Each for $139.00
Specifications Description & Specifications

Specifications

Rabbit
TUSC4
Affinity Purified
RUO
Expected identity based on immunogen sequence: Western clawed frog; Green puffer: 100%; Atlantic salmon: 100%; Human: 100%; Trichoplax reptans: 85%; Xenopus: 85%; Florida lancelet: 78%; Starlet sea anemone: 76%.
10641
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Synthetic peptide directed towards the N terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Polyclonal
Primary
Immunocytochemistry,Immunofluorescence,Western Blot
NP_006536
PBS and 2% Sucrose lyophilized with the antibody.