missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-TUSC4, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP179375SS

 View more versions of this product

Catalog No. NBP179375SS


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

TUSC4
Unlabeled
NP_006536
Rabbit
0.01mg
Primary
10641
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunocytochemistry,Immunofluorescence,Western Blot
PBS and 2% Sucrose lyophilized with the antibody.
Affinity Purified
Synthetic peptide directed towards the N terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
RUO
Polyclonal
Expected identity based on immunogen sequence: Western clawed frog; Green puffer: 100%; Atlantic salmon: 100%; Human: 100%; Trichoplax reptans: 85%; Xenopus: 85%; Florida lancelet: 78%; Starlet sea anemone: 76%.
Bovine,Canine,Guinea Pig,Human,Murine,Porcine,Rabbit,Rat,Zebrafish