Please login to your online account to display your discounted pricing

anti-TUSC4, Polyclonal, Novus Biologicals™

Manufacturer: novus biologicals canada  NBP179375SS

 View more versions of this product


For Research Use Only

Catalog No. NBP179375SS

  • / Each

Description & Specifications


Conjugate Unlabeled
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Quantity 0.01mg
Cross Reactivity Bovine
Cross Reactivity Canine
Cross Reactivity Guinea Pig
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Porcine
Cross Reactivity Rabbit
Cross Reactivity Rat
Cross Reactivity Zebrafish
Test Specificity Expected identity based on immunogen sequence: Western clawed frog; Green puffer: 100%; Atlantic salmon: 100%; Human: 100%; Trichoplax reptans: 85%; Xenopus: 85%; Florida lancelet: 78%; Starlet sea anemone: 76%.
Format Affinity Purified
Formulation PBS and 2% Sucrose lyophilized with the antibody.
Immunogen Synthetic peptide directed towards the N terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Antigen TUSC4
Gene Accession No. NP_006536
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Host Species Rabbit
Regulatory Status RUO
Gene ID (Entrez) 10641