Please login to your online account to display your discounted pricing

TUSC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™


Rabbit Polyclonal Antibody

Manufacturer: novus biologicals canada  NBP179375

 View more versions of this product

Catalog No. NBP179375

  • / Each
 

Description & Specifications

Specifications

Formulation PBS and 2% Sucrose
Gene Alias G21 protein, Gene 21 protein, homologous to yeast nitrogen permease (candidate tumor suppressor), nitrogen permease regulator 2-like protein, nitrogen permease regulator-like 2 (S. cerevisiae), NPR2, NPR2L2810446G01Rik, NPRL2, Tumor suppressor candidate 4NPR2-like protein, TUSC4
Applications Immunocytochemistry/Immunofluorescence
Applications Western Blotting
Immunogen Synthetic peptide directed towards the N-terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Purification Method Immunogen affinity purified
Quantity 100μL
Species Reactivity Human
Storage Requirements Store at -20°C. Avoid freeze-thaw cycles.
Gene ID (Entrez) 10641
Reconstitution Centrifuge at 12,000 × g for 20 seocnds. Reconstitute with 50μL distilled water to a final concentration of 1.0mg/mL in PBS buffer. Vortex followed by centrifuge again to pellet the solution.
Format Affinity Purified
Primary or Secondary Primary
Cross Reactivity Bovine
Cross Reactivity Canine
Cross Reactivity Guinea Pig
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Porcine
Cross Reactivity Rabbit
Cross Reactivity Rat
Cross Reactivity Zebrafish
Monoclonal or Polyclonal Polyclonal
Regulatory Status RUO
Test Specificity Expected identity based on immunogen sequence: Western clawed frog; Green puffer: 100%; Atlantic salmon: 100%; Human: 100%; Trichoplax reptans: 85%; Xenopus: 85%; Florida lancelet: 78%; Starlet sea anemone: 76%.
Antigen TUSC4
Host Species Rabbit
Gene Accession No. NP_006536
Conjugate Unlabeled

TUSC4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blotting.