Please login to your online account to display your discounted pricing

anti-TUSC4, Polyclonal, Novus Biologicals™

Manufacturer: novus biologicals canada  NBP1-79375

 View all options for this product

For Research Use Only

Catalog No. NBP179375

Description & Specifications

Antigen TUSC4
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Conjugate Unlabeled
Cross Reactivity Bovine
Cross Reactivity Canine
Cross Reactivity Guinea Pig
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Porcine
Cross Reactivity Rabbit
Cross Reactivity Rat
Cross Reactivity Zebrafish
Format Affinity Purified
Formulation PBS and 2% Sucrose lyophilized with the antibody.
Gene Accession No. NP_006536
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human TUSC4. The immunogen for this antibody is TUSC4. Peptide sequence MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL.
Quantity 0.05mg
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 10641
Test Specificity Expected identity based on immunogen sequence: Western clawed frog; Green puffer: 100%; Atlantic salmon: 100%; Human: 100%; Trichoplax reptans: 85%; Xenopus: 85%; Florida lancelet: 78%; Starlet sea anemone: 76%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.