missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

tubulin, epsilon 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TUBE1 protein.

Supplier:  Abnova Corporation H00051175B01

Catalog No. 89-007-605



Description

Description

This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization of the microtubules during centriole duplication. A pseudogene of this gene is found on chromosome 5

Sequence: MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM
Specifications

Specifications

tubulin, epsilon 1
Polyclonal
Mouse polyclonal antibody raised against a full-length human TUBE1 protein.
TUBE1
FLJ22589/TUBE/dJ142L7.2
Mouse
50 μL
Cell Cycle
Primary
Human
Serum
Western Blot
Unconjugated
No additive
NM_016262
TUBE1
TUBE1 (NP_057346, 1 a.a. ∼ 475 a.a) full-length human protein.
RUO
Yes
51175
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents

Documents

Product Certifications
Promotions

Promotions