missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

tRNA splicing endonuclease 34 homolog (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TSEN34.

Supplier:  Abnova Corporation H00079042A01

Catalog No. 89-004-717



Description

Description

tRNA splicing is a fundamental process required for cell growth and division. SEN34 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM

Sequence: MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSA
Specifications

Specifications

tRNA splicing endonuclease 34 homolog (S. cerevisiae)
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant TSEN34.
TSEN34
LENG5/PCH2C/SEN34/SEN34L
Mouse
50 μL
Yes
79042
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
ELISA, Western Blot
Unconjugated
50% glycerol
NM_024075
TSEN34
TSEN34 (NP_076980, 1 a.a. ∼ 99 a.a) partial recombinant protein with GST tag.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Promotions

Promotions