Please login to your online account to display your discounted pricing

anti-Testin, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP187987

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP187987

  • / Each
 

Description & Specifications

Specifications

Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Human. Expected to cross react based on sequence identity: Mouse (82%), Rat (85%).
Primary or Secondary Primary
Format Affinity Purified
Cross Reactivity Human
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 26136
Conjugate Unlabeled
Formulation PBS, pH 7.2, containing 40% glycerol
Regulatory Status RUO
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVD
Quantity 0.1mL
Host Species Rabbit
Antigen Testin