Please login to your online account to display your discounted pricing

anti-Testin, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP1-87987

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP187987

  • / Each
 

Description & Specifications

Specifications

Antigen Testin
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Conjugate Unlabeled
Cross Reactivity Human
Format Affinity Purified
Formulation PBS, pH 7.2, containing 40% glycerol
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVD
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 26136
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Human. Expected to cross react based on sequence identity: Mouse (82%), Rat (85%).