missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

single-stranded DNA binding protein 2 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SSBP2 protein.

Supplier:  Abnova Corporation H00023635B01

Catalog No. 89-007-315



Description

Description

Sequence: MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV
Specifications

Specifications

single-stranded DNA binding protein 2
Polyclonal
Mouse polyclonal antibody raised against a full-length human SSBP2 protein.
SSBP2
DKFZp686F03273/HSPC116
Mouse
50 μL
Yes
23635
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Immunofluorescence,Western Blot
Unconjugated
No additive
BC017020
SSBP2
SSBP2 (AAH17020, 1 a.a. ∼ 361 a.a) full-length human protein.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Product Certifications
Promotions

Promotions