missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

sorting nexin 24, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SNX24 protein.

Supplier:  Abnova Corporation H00028966B01

Catalog No. 89-007-471



Description

Description

Sequence: MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
Specifications

Specifications

sorting nexin 24
Polyclonal
Mouse polyclonal antibody raised against a full-length human SNX24 protein.
SNX24
PRO1284/SBBI31
Mouse
50 μL
Signal Transduction
Primary
Human
Serum
Western Blot
Unconjugated
No additive
NM_014035
SNX24
SNX24 (NP_054754, 1 a.a. ∼ 169 a.a) full-length human protein.
RUO
Yes
28966
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents

Documents

Product Certifications
Promotions

Promotions