missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

SET domain containing (lysine methyltransferase) 7, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SET7.

Supplier:  Abnova Corporation H00080854A01

Catalog No. 89-004-729



Description

Description

Sequence: SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK
Specifications

Specifications

SET domain containing (lysine methyltransferase) 7
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant SET7.
SETD7
FLJ21193/KIAA1717/KMT7/SET7/SET7/9/SET9
Mouse
50 μL
Yes
80854
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
ELISA, Western Blot
Unconjugated
50% glycerol
NM_030648
SETD7
SET7 (NP_085151, 257 a.a. ∼ 366 a.a) partial recombinant protein with GST tag.
RUO
Primary
Human, Rat
Serum
SDS
Documents

Documents

Promotions

Promotions