pumilio homolog 2 (Drosophila), Mouse, Clone: 1C8, Abnova™

Name: pumilio homolog 2 (Drosophila), Mouse, Clone: 1C8, Abnova&trade;
Brand: Abnova Corporation
SKU: 89-001-227
Price: 392.20 CAD

Mouse monoclonal antibody raised against a partial recombinant PUM2.

Supplier: Abnova Corporation H00023369M02

Catalog No. 89-001-227

Quantity

Description

Sequence: DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATR

Specifications

Antigen	pumilio homolog 2 (Drosophila)
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_015317
Gene Symbols	PUM2
Immunogen	PUM2 (NP_056132, 701 a.a. ∼ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Whole Molecule	Yes
Gene ID (Entrez)	23369
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG1 κ

Applications	ELISA, Western Blot
Clone	1C8
Description	Mouse monoclonal antibody raised against a partial recombinant PUM2.
Gene	PUM2
Gene Alias	FLJ36528/KIAA0235/MGC138251/MGC138253/PUMH2/PUML2
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Description