missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

par-6 partitioning defective 6 homolog alpha (C. elegans) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PARD6A.

Supplier:  Abnova Corporation H00050855A01

Catalog No. 89-004-616



Description

Description

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: KPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQGQASSGWGSRIRGDGSGFSL
Specifications

Specifications

par-6 partitioning defective 6 homolog alpha (C. elegans)
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant PARD6A.
PARD6A
PAR-6A/PAR6/PAR6C/PAR6alpha/TAX40/TIP-40
Mouse
50 μL
Cell Cycle
Primary
Human
Serum
ELISA, Western Blot
Unconjugated
50% glycerol
NM_016948
PARD6A
PARD6A (NP_058644, 247 a.a. ∼ 346 a.a) partial recombinant protein with GST tag.
RUO
Yes
50855
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents

Documents

Promotions

Promotions