missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-OTUD6B, Polyclonal, Novus Biologicals™

$461.00 - $461.00

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
Antigen OTUD6B
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP185652 Novus Biologicals Canada
NBP185652
0.1mL Each for $461.00
Specifications Description & Specifications

Specifications

Rabbit
OTUD6B
Affinity Purified
RUO
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Human. Mouse and Rat reactivity determined by Western Blot.
PBS, pH 7.2, containing 40% glycerol
This antibody was developed against Recombinant Protein corresponding to amino acids:HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
Polyclonal
Primary
Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
51633