Please login to your online account to display your discounted pricing

anti-OTUD6B, Polyclonal, Novus Biologicals™

Manufacturer: novus biologicals canada  NBP185652

 View more versions of this product


For Research Use Only

Catalog No. NBP185652

  • / Each

Description & Specifications


Antigen OTUD6B
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blot
Conjugate Unlabeled
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Rat
Format Affinity Purified
Formulation PBS, pH 7.2, containing 40% glycerol
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 51633
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Human. Mouse and Rat reactivity determined by Western Blot.
Target Species Human
Target Species Murine
Target Species Rat