Please login to your online account to display your discounted pricing

anti-OTUD6B, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP185652

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP185652

  • / Each
 

Description & Specifications

Specifications

Host Species Rabbit
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Rat
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Human. Mouse and Rat reactivity determined by Western Blot.
Conjugate Unlabeled
Monoclonal or Polyclonal Polyclonal
Primary or Secondary Primary
Gene ID (Entrez) 51633
Formulation PBS, pH 7.2, containing 40% glycerol
Quantity 0.1mL
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Regulatory Status RUO
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
Format Affinity Purified
Antigen OTUD6B