missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-OTUD6B, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP185652

 View more versions of this product

Catalog No. NBP185652


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

OTUD6B
Unlabeled
Affinity Purified
This antibody was developed against Recombinant Protein corresponding to amino acids:HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
RUO
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Human. Mouse and Rat reactivity determined by Western Blot.
Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
PBS, pH 7.2, containing 40% glycerol
Rabbit
0.1mL
Primary
51633
Human,Murine,Rat