missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

nascent polypeptide-associated complex alpha subunit 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NACAL.

Supplier:  Abnova Corporation H00342538A01

Catalog No. 89-004-830



Description

Description

Sequence: ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Specifications

Specifications

nascent polypeptide-associated complex alpha subunit 2
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant NACAL.
NACA2
ANAC/MGC71999/NACAL
Mouse
50 μL
Yes
342538
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
ELISA, Western Blot
Unconjugated
50% glycerol
NM_199290
NACA2
NACAL (NP_954984, 116 a.a. ∼ 215 a.a) partial recombinant protein with GST tag.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Promotions

Promotions