Please login to your online account to display your discounted pricing

anti-MX2, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP181018

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP181018

  • / Each
 

Description & Specifications

Specifications

Formulation PBS, pH 7.2, containing 40% glycerol
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Monoclonal or Polyclonal Polyclonal
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected to cross react based on sequence identity: Mouse (28%), Rat (29%).
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Primary or Secondary Primary
Conjugate Unlabeled
Cross Reactivity Human
Quantity 0.1mL
Gene ID (Entrez) 4600
Gene Accession No. P20592
Regulatory Status RUO
Antigen MX2
Format Affinity Purified
Host Species Rabbit