Please login to your online account to display your discounted pricing

anti-MX2, Polyclonal, Novus Biologicals™

Manufacturer: novus biologicals canada  NBP1-81018

 View all options for this product


For Research Use Only

Catalog No. NBP181018


Description & Specifications


Antigen MX2
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Conjugate Unlabeled
Cross Reactivity Human
Format Affinity Purified
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Accession No. P20592
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 4600
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected to cross react based on sequence identity: Mouse (28%), Rat (29%).