missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-MX2, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP181018

 View more versions of this product

Catalog No. NBP181018


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

MX2
Unlabeled
P20592
Rabbit
0.1mL
Primary
4600
Human
Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
PBS, pH 7.2, containing 40% glycerol
Affinity Purified
This antibody was developed against Recombinant Protein corresponding to amino acids:PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
RUO
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected to cross react based on sequence identity: Mouse (28%), Rat (29%).