Please login to your online account to display your discounted pricing

anti-MX2, Polyclonal, Novus Biologicals™

$461.00 - $461.00


Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Antigen MX2
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs


For Research Use Only

Catalog Number Mfr. No. Conjugate Quantity Price Quantity    


novus biologicals canada
Unlabeled 0.1mL Each for $461.00
Description & Specifications


Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Antigen MX2
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
Primary or Secondary Primary
Regulatory Status RUO
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blot
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected to cross react based on sequence identity: Mouse (28%), Rat (29%).
Gene Accession No. P20592
Gene ID (Entrez) 4600
Formulation PBS, pH 7.2, containing 40% glycerol