missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MTHFD1L.

Supplier:  Abnova Corporation H00025902A01

Catalog No. 89-004-576



Description

Description

One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM

Sequence: VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
Specifications

Specifications

methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant MTHFD1L.
MTHFD1L
DKFZp586G1517/FLJ21145/FTHFSDC1/MTC1THFS/dJ292B18.2
Mouse
50 μL
Yes
25902
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
ELISA, Western Blot
Unconjugated
50% glycerol
NM_015440
MTHFD1L
MTHFD1L (NP_056255, 801 a.a. ∼ 899 a.a) partial recombinant protein with GST tag.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Promotions

Promotions