missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

mitochondrial ribosomal protein S30, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MRPS30 protein.

Supplier:  Abnova Corporation H00010884B01

Catalog No. 89-007-076



Description

Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that is similar to the chicken pro-apoptotic protein p52. Transcript variants using alternative promoters or polyA sites have been mentioned in the literature but the complete description of these sequences is not available. [provided by RefSeq

Sequence: MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN
Specifications

Specifications

mitochondrial ribosomal protein S30
Polyclonal
Mouse polyclonal antibody raised against a full-length human MRPS30 protein.
MRPS30
DKFZp566B2024/MRP-S30/PAP/PDCD9
Mouse
50 μL
Apoptosis
Primary
Human
Serum
Western Blot
Unconjugated
No additive
NM_016640
MRPS30
MRPS30 (NP_057724, 1 a.a. ∼ 439 a.a) full-length human protein.
RUO
Yes
10884
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents

Documents

Product Certifications
Promotions

Promotions