Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™


Manufacturer: novus biologicals canada  NB11057131

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NB11057131

  • / Each
 

Description & Specifications

Specifications

Test Specificity Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
Isotype IgG1
Primary or Secondary Primary
Gene ID (Entrez) 4363
Cross Reactivity Human
Cross Reactivity Mouse
Monoclonal or Polyclonal Monoclonal
Conjugate Unlabeled
Gene Accession No. P33527
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Quantity 0.1mL
Regulatory Status RUO
Host Species Mouse
Clone IU5C1
Format Ascites
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Antigen MRP1