Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™


Manufacturer: novus biologicals canada  NB11057131

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NB11057131

  • / Each
 

Description & Specifications

Specifications

Test Specificity Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
Cross Reactivity Human
Cross Reactivity Mouse
Isotype IgG1
Gene ID (Entrez) 4363
Primary or Secondary Primary
Conjugate Unlabeled
Monoclonal or Polyclonal Monoclonal
Gene Accession No. P33527
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Regulatory Status RUO
Quantity 0.1mL
Host Species Mouse
Clone IU5C1
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Format Ascites
Antigen MRP1