Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™

Manufacturer: novus biologicals canada  NB110-57131

 View all options for this product

For Research Use Only

Catalog No. NB11057131

Description & Specifications

Antigen MRP1
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Clone IU5C1
Conjugate Unlabeled
Cross Reactivity Human
Cross Reactivity Mouse
Format Ascites
Gene Accession No. P33527
Host Species Mouse
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Isotype IgG1
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Monoclonal
Gene ID (Entrez) 4363
Test Specificity Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.