missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™

$109.00 - $309.05

Specifications

Clone IU5C1
Host Species Murine
Isotype IgG1
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Antigen MRP1
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NB11057131 Novus Biologicals Canada
NB11057131
0.1mL Each for $309.05
NB11057131T Novus Biologicals Canada
NB11057131SS
0.025mL Each for $109.00
Specifications Description & Specifications

Specifications

IU5C1
IgG1
MRP1
Ascites
RUO
Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
4363
Murine
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Monoclonal
Primary
Immunocytochemistry,Immunofluorescence,Western Blot
P33527