Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™

$106.00 - $321.00

Specifications

Clone IU5C1
Host Species Mouse
Isotype IgG1
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Antigen MRP1
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Conjugate Quantity Price Quantity    

NB11057131

 
novus biologicals canada
NB110-57131
Unlabeled 0.1mL Each for $321.00

NB11057131T

 
novus biologicals canada
NB110-57131SS
Unlabeled 0.025mL Each for $106.00
Description & Specifications

Specifications

Clone IU5C1
Host Species Mouse
Isotype IgG1
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Antigen MRP1
Monoclonal or Polyclonal Monoclonal
Format Ascites
Primary or Secondary Primary
Regulatory Status RUO
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Test Specificity Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
Gene Accession No. P33527
Gene ID (Entrez) 4363