missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NB11057131SS

 View more versions of this product

Catalog No. NB11057131T



For Research Use Only

Specifications Description & Specifications


Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
Immunocytochemistry,Immunofluorescence,Western Blot
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]