Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™


Manufacturer: novus biologicals canada  NB110-57131SS

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NB11057131T

  • / Each
 

Description & Specifications

Specifications

Antigen MRP1
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Clone IU5C1
Conjugate Unlabeled
Cross Reactivity Human
Cross Reactivity Mouse
Format Ascites
Gene Accession No. P33527
Host Species Mouse
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Isotype IgG1
Quantity 0.025mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Monoclonal
Gene ID (Entrez) 4363
Test Specificity Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.