Please login to your online account to display your discounted pricing

anti-MRP1, Clone: IU5C1, Novus Biologicals™

Manufacturer: novus biologicals canada  NB11057131SS

 View more versions of this product


For Research Use Only

Catalog No. NB11057131T

  • / Each

Description & Specifications


Test Specificity Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.
Format Ascites
Isotype IgG1
Gene ID (Entrez) 4363
Monoclonal or Polyclonal Monoclonal
Conjugate Unlabeled
Primary or Secondary Primary
Regulatory Status RUO
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Western Blotting
Gene Accession No. P33527
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot No. P33527]
Quantity 0.025mL
Cross Reactivity Human
Cross Reactivity Mouse
Host Species Mouse
Antigen MRP1
Clone IU5C1