Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N8G7, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP227365SS

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP227365SS

  • / Each
 

Description & Specifications

Specifications

Formulation 100μg antibody in 200μL PBS containing 0.05% BSA.
Gene Accession No. Q8NFR9
Monoclonal or Polyclonal Monoclonal
Concentration 0.5mg/mL
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Isotype κ
Primary or Secondary Primary
Gene ID (Entrez) 132014
Antigen IL-17 RE
Format Purified
Host Species Mouse
Applications Western Blotting
Quantity 0.025mg
Conjugate Unlabeled
Regulatory Status RUO
Clone 46N8G7
Cross Reactivity Human