Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N8G7, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP227365

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP227365

  • / Each
 

Description & Specifications

Specifications

Conjugate Unlabeled
Gene Accession No. Q8NFR9
Formulation 100μg antibody in 200μL PBS containing 0.05% BSA.
Gene ID (Entrez) 132014
Monoclonal or Polyclonal Monoclonal
Concentration 0.5mg/mL
Isotype κ
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Host Species Mouse
Applications Western Blotting
Format Purified
Cross Reactivity Human
Regulatory Status RUO
Quantity 0.1mg
Primary or Secondary Primary
Clone 46N8G7
Antigen IL-17 RE