Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N8G7, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP227365

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP227365

  • / Each
 

Description & Specifications

Specifications

Gene Accession No. Q8NFR9
Conjugate Unlabeled
Formulation 100μg antibody in 200μL PBS containing 0.05% BSA.
Gene ID (Entrez) 132014
Host Species Mouse
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Isotype κ
Monoclonal or Polyclonal Monoclonal
Concentration 0.5mg/mL
Format Purified
Applications Western Blotting
Cross Reactivity Human
Quantity 0.1mg
Regulatory Status RUO
Primary or Secondary Primary
Clone 46N8G7
Antigen IL-17 RE