Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N7E3, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP227368SS

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP227368SS

  • / Each
 

Description & Specifications

Specifications

Formulation 100μg antibody in 200μL PBS containing 0.05% BSA.
Applications Flow Cytometry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Primary or Secondary Primary
Monoclonal or Polyclonal Monoclonal
Gene Accession No. Q8NFR9
Isotype κ
Cross Reactivity Human
Host Species Mouse
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Quantity 0.025mg
Regulatory Status RUO
Antigen IL-17 RE
Format Purified
Gene ID (Entrez) 132014
Clone 46N7E3
Concentration 0.5mg/mL
Conjugate Unlabeled