Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N7E3, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP227368

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP227368

  • / Each
 

Description & Specifications

Specifications

Monoclonal or Polyclonal Monoclonal
Primary or Secondary Primary
Concentration 0.5mg/mL
Gene Accession No. Q8NFR9
Gene ID (Entrez) 132014
Cross Reactivity Human
Host Species Mouse
Applications Flow Cytometry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Quantity 0.1mg
Formulation 100μg antibody in 200μL PBS containing 0.05% BSA.
Regulatory Status RUO
Clone 46N7E3
Format Purified
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Isotype κ
Conjugate Unlabeled
Antigen IL-17 RE