missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N7E3, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP227368

 View more versions of this product

Catalog No. NBP227368


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

IL-17 RE
46N7E3
Unlabeled
Q8NFR9
Murine
κ
RUO
Monoclonal
Human
Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
0.5mg/mL
100μg antibody in 200μL PBS containing 0.05% BSA.
Purified
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
0.1mg
Primary
132014