Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N7E3, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP227368

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP227368

  • / Each
 

Description & Specifications

Specifications

Monoclonal or Polyclonal Monoclonal
Concentration 0.5mg/mL
Primary or Secondary Primary
Gene ID (Entrez) 132014
Cross Reactivity Human
Gene Accession No. Q8NFR9
Quantity 0.1mg
Host Species Mouse
Applications Flow Cytometry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Formulation 100μg antibody in 200μL PBS containing 0.05% BSA.
Clone 46N7E3
Regulatory Status RUO
Isotype κ
Format Purified
Conjugate Unlabeled
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Antigen IL-17 RE