Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N7E3, Novus Biologicals™

$106.00 - $278.00

Specifications

Clone 46N7E3
Host Species Mouse
Isotype κ
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Antigen IL-17 RE
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Conjugate Quantity Price Quantity    

NBP227368

 
novus biologicals canada
NBP2-27368
Unlabeled 0.1mg Each for $278.00

NBP227368SS

 
novus biologicals canada
NBP2-27368SS
Unlabeled 0.025mg Each for $106.00
Description & Specifications

Specifications

Clone 46N7E3
Host Species Mouse
Isotype κ
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Antigen IL-17 RE
Monoclonal or Polyclonal Monoclonal
Format Purified
Primary or Secondary Primary
Regulatory Status RUO
Applications Flow Cytometry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Gene Accession No. Q8NFR9
Gene ID (Entrez) 132014
Formulation 100μg antibody in 200μL PBS containing 0.05% BSA.
Concentration 0.5mg/mL