missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-IL-17 RE, Clone: 46N7E3, Novus Biologicals™

$109.00 - $255.80

Specifications

Clone 46N7E3
Host Species Murine
Isotype κ
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Antigen IL-17 RE
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP227368 Novus Biologicals Canada
NBP227368
0.1mg Each for $255.80
NBP227368SS Novus Biologicals Canada
NBP227368SS
0.025mg Each for $109.00
Specifications Description & Specifications

Specifications

46N7E3
κ
IL-17 RE
Purified
RUO
Q8NFR9
100μg antibody in 200μL PBS containing 0.05% BSA.
Murine
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Monoclonal
Primary
Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
132014
0.5mg/mL