missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

LAG1 homolog, ceramide synthase 6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LASS6.

Supplier:  Abnova Corporation H00253782A01

Catalog No. 89-004-823



Description

Description

Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Specifications

Specifications

LAG1 homolog, ceramide synthase 6
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant LASS6.
LASS6
CerS6/MGC129949/MGC129950
Mouse
50 μL
Yes
253782
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
ELISA, Western Blot
Unconjugated
50% glycerol
NM_203463
LASS6
LASS6 (NP_982288, 62 a.a. ∼ 131 a.a) partial recombinant protein with GST tag.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Promotions

Promotions