hydroxysteroid (17-beta) dehydrogenase 3, Mouse, Polyclonal Antibody, Abnova™

Name: hydroxysteroid (17-beta) dehydrogenase 3, Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova Corporation
SKU: 89-004-155
Price: 270.10 CAD

Mouse polyclonal antibody raised against a partial recombinant HSD17B3.

Supplier: Abnova Corporation H00003293A01

Catalog No. 89-004-155

$270.10 / Each

Quantity

Description

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq

Sequence: RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK

Specifications

Antigen	hydroxysteroid (17-beta) dehydrogenase 3
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant HSD17B3.
Gene	HSD17B3
Gene Alias	EDH17B3/SDR12C2
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	3293
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_000197
Gene Symbols	HSD17B3
Immunogen	HSD17B3 (NP_000188, 29 a.a. ∼ 119 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse
Form	Serum

hydroxysteroid (17-beta) dehydrogenase 3, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Documents

Promotions