missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

hook homolog 1 (Drosophila) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HOOK1.

Supplier:  Abnova Corporation H00051361A01

Catalog No. 89-004-629



Description

Description

This gene encodes a member of the hook family of coiled-coil proteins, which bind to microtubules and organelles through their N- and C-terminal domains, respectively. The encoded protein localizes to discrete punctuate subcellular structures, and interacts with several members of the Rab GTPase family involved in endocytosis. It is thought to link endocytic membrane trafficking to the microtubule cytoskeleton. Several alternatively spliced transcript variants have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: MLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTPARSFLAQQRHITNTRRNLSVKVPATTSD
Specifications

Specifications

hook homolog 1 (Drosophila)
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant HOOK1.
HOOK1
HK1/MGC10642
Mouse
50 μL
Yes
51361
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
ELISA, Western Blot
Unconjugated
50% glycerol
NM_015888
HOOK1
HOOK1 (NP_056972, 632 a.a. ∼ 728 a.a) partial recombinant protein with GST tag.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Promotions

Promotions