missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

GLI-Kruppel family member GLI4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human GLI4 protein.

Supplier:  Abnova Corporation H00002738B01

Catalog No. 89-005-445



Description

Description

Sequence: MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE
Specifications

Specifications

GLI-Kruppel family member GLI4
Polyclonal
Mouse polyclonal antibody raised against a full-length human GLI4 protein.
GLI4
HKR4
Mouse
50 μL
Yes
2738
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Immunofluorescence, Western Blot
Unconjugated
No additive
NM_138465.3
GLI4
GLI4 (NP_612474.1, 1 a.a. ∼ 376 a.a) full-length human protein.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Promotions

Promotions