Please login to your online account to display your discounted pricing

anti-FCRN/FCGRT, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP189128

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP189128

  • / Each
 

Description & Specifications

Specifications

Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected to cross react based on sequence identity: Mouse (72%), Rat (73%).
Conjugate Unlabeled
Cross Reactivity Human
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Accession No. P55899
Quantity 0.1mL
Gene ID (Entrez) 2217
Applications Immunohistochemistry
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Format Affinity Purified
Antigen FCRN/FCGRT
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Primary or Secondary Primary
Host Species Rabbit
Monoclonal or Polyclonal Polyclonal
Regulatory Status RUO