missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

elongation protein 4 homolog (S. cerevisiae) (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human ELP4 protein.

Supplier:  Abnova Corporation H00026610B01

Catalog No. 89-007-408



Description

Description

This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq

Sequence: MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKLFTIEAGVQWHDLGSRRPRLLGSGGSPASASLVAGITGAHHHAQLIFVFLVEMGFHHVGQAGLELLTSGDSSASASQSAGIAGMSYRARPRALYFKENKSKVGARQLLETREEHLSSRLLILTQAERLCMGRRFFTAFHIFNELPCKGDCICLQTCQTQ
Specifications

Specifications

elongation protein 4 homolog (S. cerevisiae)
Polyclonal
Mouse polyclonal antibody raised against a full-length human ELP4 protein.
ELP4
C11orf19/FLJ20498/PAX6NEB/PAXNEB/dJ68P15A.1
Mouse
50 μL
Kinases
Primary
Human
Serum
Immunofluorescence,Western Blot
Unconjugated
No additive
BC012514.1
ELP4
ELP4 (AAH12514.1, 1 a.a. ∼ 535 a.a) full-length human protein.
RUO
Yes
26610
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents

Documents

Product Certifications
Promotions

Promotions