missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

cytochrome c, somatic, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CYCS protein.

Supplier:  Abnova Corporation H00054205B01

Catalog No. 89-007-730



Description

Description

This gene encodes cytochrome c, a component of the electron transport chain in mitochondria. The heme group of cytochrome c accepts electrons from the b-c1 complex and transfers electrons to the cytochrome oxidase complex. Cytochrome c is also involved in initiation of apoptosis. Upon release of cytochrome c to the cytoplasm, the protein binds apoptotic protease activating factor which activates the apoptotic initiator procaspase 9. Many cytochrome c pseudogenes exist, scattered throughout the human genome. [provided by RefSeq

Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Specifications

Specifications

cytochrome c, somatic
Polyclonal
Mouse polyclonal antibody raised against a full-length human CYCS protein.
CYCS
CYC/HCS
Mouse
50 μL
Yes
54205
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot
Unconjugated
No additive
BC005299
CYCS
CYCS (AAH05299, 1 a.a. ∼ 105 a.a) full-length human protein.
RUO
Primary
Human
Serum
SDS
Documents

Documents

Product Certifications
Promotions

Promotions