missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-CD45, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP188103

 View more versions of this product

Catalog No. NBP188103


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

CD45
Unlabeled
Affinity Purified
This antibody was developed against Recombinant Protein corresponding to amino acids:KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
RUO
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Expected identity based on immunogen sequence: Mouse (35%), Rat (37%)
Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
PBS, pH 7.2, containing 40% glycerol
Rabbit
0.1mL
Primary
5788
Human