Please login to your online account to display your discounted pricing

anti-ATAD2, Polyclonal, Novus Biologicals™

$450.00 - $450.00

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Antigen ATAD2
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Conjugate Quantity Price Quantity    

NBP184123

 
novus biologicals canada
NBP1-84123
Unlabeled 0.1mL Each for $450.00
Description & Specifications

Specifications

Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Antigen ATAD2
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
Primary or Secondary Primary
Regulatory Status RUO
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Possible cross-reactivity based on sequence identity: Mouse (82%), Rat (82%).
Gene Accession No. Q6PL18
Gene ID (Entrez) 29028
Formulation PBS, pH 7.2, containing 40% glycerol